PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021290P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 557aa    MW: 61736.6 Da    PI: 6.329
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021290P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.3e-29103156155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  MELO3C021290P2 103 KPRVVWSVELHQQFVAAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 156
                     79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.4E-8167No hitNo description
SuperFamilySSF521728.6E-6147IPR011006CheY-like superfamily
PROSITE profilePS5011014.186139IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF466892.87E-20100160IPR009057Homeodomain-like
PROSITE profilePS5129411.048100159IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-30102161IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-25103156IPR006447Myb domain, plants
PfamPF002497.5E-8105155IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MSADDGKNVV MKGVIHGACD YLIKPVRIEA LRNIWQHVVR KRKTEWKDLE QSGSVDEGDR  60
EQNLSEGANY SSSAYEGSWN SSKRRRDAEE EPEERDDTST LKKPRVVWSV ELHQQFVAAV  120
NQLGIDKAVP KKILELMNVP GLTRENVASH LQKYRLYLRR LSGVSPHQSN LNNSFINPQD  180
PPFGSMGSFN GIDLQTLSVT GQLSPQSLAA LQATGLRRPT AKSSISMALV DQNNIFSFEN  240
PKLRFVEDQT QHLNNSKPVN LFHEIPTKIE PKQLGNIQHS SVQPQGNINM QLNIKSEHSG  300
TQLMHLSQQQ TLGHSPASHL PRIPSTLRKP IISGSVTRGN GTTDNSHRPG YNLVSPTSVM  360
VNYPMSQTTE LSNNYSLQSN SSVSTLNCKG VFQEEISSDL KVSGGLMSSY DVFSDLPLQK  420
SHDWDSQNVN TLAFGTFHHG NFMQDSFDIS PSTLIHHGFP SSQMNGQNQN SSVVGKTMFS  480
FSDLTQPENP QNIAQNSLLD PVEVKSQKIP DANYQTDLLS DDFGQDELLG VFLKQQQQGD  540
DGSVDFSGYQ TENICV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-22102162464ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819240.0LN681924.1 Cucumis melo genomic scaffold, anchoredscaffold00047.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008458388.10.0PREDICTED: two-component response regulator ARR2-like isoform X1
TrEMBLA0A0A0KF030.0A0A0A0KF03_CUCSA; Uncharacterized protein
STRINGGLYMA07G37220.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-110response regulator 2